PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000896551
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 361aa    MW: 40191.9 Da    PI: 7.9785
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000896551genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.79.6e-121450141
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41
                     rg WT+eEd +l  +++q+G+++W++I++  g +   ++ck
    MDP0000896551 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKNAG-N---YNCK 50
                     89*****************************9.4...7776 PP

2Myb_DNA-binding45.22.2e-1499141246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++  E++ +v+++   G++ W++Ia+ ++ gRt++++k++w++
    MDP0000896551  99 GQFSDAEEQTIVKYHSVVGNR-WSLIAAQLP-GRTDNDVKNHWNT 141
                      7899*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-23595IPR009057Homeodomain-like
SuperFamilySSF466893.01E-8943IPR009057Homeodomain-like
PROSITE profilePS5129413.001956IPR017930Myb domain
SMARTSM007176.1E-101394IPR001005SANT/Myb domain
PfamPF002492.2E-91446IPR001005SANT/Myb domain
CDDcd001672.16E-81792No hitNo description
SuperFamilySSF466896.27E-2178150IPR009057Homeodomain-like
PROSITE profilePS5129425.07593147IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-2496147IPR009057Homeodomain-like
SMARTSM007171.0E-1297145IPR001005SANT/Myb domain
PfamPF002491.3E-1299141IPR001005SANT/Myb domain
CDDcd001671.99E-9101143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGRIPCCEKD NVKRGQWTPE EDNKLSSYIA QHGTRNWRLI PKNAGNYNCK ALSLSLSLSP  60
SLRPSLLKRS SFGLQGLQRC GKSCRLRWTN YLRPDLKHGQ FSDAEEQTIV KYHSVVGNRW  120
SLIAAQLPGR TDNDVKNHWN TKLKKKLSGM GIDPVTHKPF SHLMAEIATT LAPPQVAHLA  180
EAALGCFKDE MLHLLMKKRI DFHQHTNPTP GNSTATYINS QQEEKLDTVK KIKIGLSRAM  240
QEQPDMLTSN KPWMDTIGAT SANFTXNCSD FPLPMSGFQY GHSTFGNEGD GSPWSQSLCT  300
GSTCTGAADQ QGQLADKLEV EENGEESEXR KELRNGSSNI FNSDSLLWDL PSEDLMNQMV  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141477108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008353730.10.0PREDICTED: transcriptional activator Myb
SwissprotQ7XQN11e-117MYB80_ORYSJ; Transcription factor MYB80
TrEMBLM5WEW70.0M5WEW7_PRUPE; Uncharacterized protein
STRINGVIT_19s0015g01280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108783039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-113myb domain protein 103